PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c11_2650V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 608aa    MW: 66647 Da    PI: 7.6501
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c11_2650V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.2e-17163208147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        rg W + Ed++l ++v ++G+ +W++Ia++++ gR++k+c++rw++ 
  Pp3c11_2650V3.2.p 163 RGHWRPVEDQKLRELVSLHGPQNWNLIAEKLQ-GRSGKSCRLRWFNQ 208
                        899*****************************.***********996 PP

2Myb_DNA-binding49.97.5e-16215259147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        r ++T+eE+e+l+ a ++ G++ W++Iar ++ gRt++ +k++w+ +
  Pp3c11_2650V3.2.p 215 RRPFTEEEEERLLAANQLQGNK-WALIARLFP-GRTDNAVKNHWHVL 259
                        679*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.606158213IPR017930Myb domain
SMARTSM007171.8E-14162211IPR001005SANT/Myb domain
PfamPF002491.3E-16163208IPR001005SANT/Myb domain
SuperFamilySSF466894.12E-27163256IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-26164216IPR009057Homeodomain-like
CDDcd001675.07E-13166207No hitNo description
PROSITE profilePS5129418.806214264IPR017930Myb domain
SMARTSM007172.3E-13214262IPR001005SANT/Myb domain
PfamPF002496.1E-13215258IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-19217264IPR009057Homeodomain-like
CDDcd001671.47E-5228259No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 608 aa     Download sequence    Send to blast
MEIEEMGSWA ADTTKIMGHH FTLEAERMRS FNKSQNSETP YNASVQLDKD YSASRQSGFS  60
QVRSFSALET LTTGGERTSN SGSNTGTPVC EAIPFELLSM SPDKRPWRTY SVESCSGFAP  120
ELKLSSEDDT EHGSLDDKKE SNEDMVISGG KDGDSVQSKL CSRGHWRPVE DQKLRELVSL  180
HGPQNWNLIA EKLQGRSGKS CRLRWFNQLD PRINRRPFTE EEEERLLAAN QLQGNKWALI  240
ARLFPGRTDN AVKNHWHVLT ARKMRERSRI SGRRKSEVHR KNKGNCTYTS AQGNHYHGST  300
DPLTLWIEPK YTATAESAEA PPRSSLSGSG SPLSLPTAFA KQQSSGGTLH SVANMGTSCL  360
SDVTSLSPKY RNLGSATMVA LPLLPNPVGS VISDHRPVHL PEVTNSAMNQ ALLSNSTDGQ  420
ISSGFLMRAL DPLAENLATL PTHQQTTDNH CVRLETNVPG SLNAGARAHR RSQSLVSFGH  480
NDKVGEYESY PGASLCHSDV LHRQLSSSQL NCSAAYNTGR YQSENYSGRN KPPFLQGNRN  540
KDVGSLSTQV HQRQEKPHND TESALKMGPC WAAADNTYDL GVVGMAISQP EQSVPVAFFD  600
FLGVGAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-301632647108B-MYB
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S39_301V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.12e-63myb domain protein 105